Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HSD3B1 protein

This Human HSD3B1 protein spans the amino acid sequence from region 2-237aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I

UniProt

P14060

Expression Region

2-237aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAC-1 shRNA (m) Lentiviral Particles
sc-153007-V 200 µL

TRAC-1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
PTPN22 (NM_012411) Human Tagged Lenti ORF Clone
RC215662L3 10 µg

PTPN22 (NM_012411) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Vanin 1 Rabbit Polyclonal Antibody
orb556907 100 µL

Vanin 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Methyl 4- (4-cyanophenoxy) benzoate
OR1056288-01 100 mg

Methyl 4- (4-cyanophenoxy) benzoate

Sign In for Pricing
View Details
Methyl 4- (4-cyanophenoxy) benzoate
OR1056288-02 250 mg

Methyl 4- (4-cyanophenoxy) benzoate

Sign In for Pricing
View Details
Olr1681 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7373005 3x 1.0 µg

Olr1681 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details