Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HSD3B1 protein

This Human HSD3B1 protein spans the amino acid sequence from region 2-237aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I

UniProt

P14060

Expression Region

2-237aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLJCOR18 ORF Vector (Human) (pORF)
ORF021759 1.0 µg DNA

IGLJCOR18 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Gcgr-set siRNA/shRNA/RNAi Lentivector (Mouse)
21381094 4x 500 ng

Gcgr-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
VPS8 (NM_015303) Human Tagged Lenti ORF Clone
RC222546L3 10 µg

VPS8 (NM_015303) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Hgsnat Mouse siRNA Oligo Duplex (Locus ID 52120)
SR418345 1 Kit

Hgsnat Mouse siRNA Oligo Duplex (Locus ID 52120)

Sign In for Pricing
View Details
Ppfia2 ORF Vector (Rat) (pORF)
37313016 1.0 µg DNA

Ppfia2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
3- (Cyanoamino) benzoic acid
IHA43027-01 100 mg

3- (Cyanoamino) benzoic acid

Sign In for Pricing
View Details