Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pth protein

This Rat Pth protein spans the amino acid sequence from region 32-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parathyrin

UniProt

P04089

Expression Region

32-115aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken/Turkey IgY (IgG) ELISA Kit, 96 tests
6030 1 Kit

Chicken/Turkey IgY (IgG) ELISA Kit, 96 tests

Sign In for Pricing
View Details
Anti-IgG Antibody
V2620IHC-7ML 7 mL

Anti-IgG Antibody

Sign In for Pricing
View Details
Mouse Monoclonal FNDC4 Antibody (OTI1B7) [Alexa Fluor 750]
NBP2-72151AF750 0.1 mL

Mouse Monoclonal FNDC4 Antibody (OTI1B7) [Alexa Fluor 750]

Sign In for Pricing
View Details
ZNF71 siRNA (Human)
orb1856538-01 15 nmol

ZNF71 siRNA (Human)

Sign In for Pricing
View Details
ZNF71 siRNA (Human)
orb1856538-02 30 nmol

ZNF71 siRNA (Human)

Sign In for Pricing
View Details
PLA2G4A Knockout Cell Lysate
ABC-KC1490 100 µg

PLA2G4A Knockout Cell Lysate

Sign In for Pricing
View Details