Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pth protein

This Rat Pth protein spans the amino acid sequence from region 32-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parathyrin

UniProt

P04089

Expression Region

32-115aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HSP70/HSPA1A Antibody [Alexa Fluor 488]
NBP1-77456AF488 0.1 mL

Rabbit Polyclonal HSP70/HSPA1A Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
HP1 gamma Recombinant Antibody, PE-Cy7 Conjugated
bsm-61603R-PE-Cy7-TR 20 µL

HP1 gamma Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Phenyl 2-Chloroethyl Ether
P4061-35 1 g

Phenyl 2-Chloroethyl Ether

Sign In for Pricing
View Details
Cytokeratin 5 Antibody
orb1318880 100 µL

Cytokeratin 5 Antibody

Sign In for Pricing
View Details
S100A1 Monoclonal Antibody, APC-Cy7 Conjugated
bsm-63045R-APC-Cy7 100 µL

S100A1 Monoclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
ARL16 Protein Vector (Mouse) (pPM-C-HA)
PV156140 500 ng

ARL16 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details