Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DUX4 protein

This Human DUX4 protein spans the amino acid sequence from region 327-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Double homeobox protein 10

UniProt

Q9UBX2

Expression Region

327-424aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL12A Antibody
E30AC471 100 µL

IL12A Antibody

Sign In for Pricing
View Details
NIPA Rabbit pAb, PerCP-Cy7 conjugated
orb2879564 100 µL

NIPA Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
TSHRAb (Thyroid Stimulating Hormone Receptor Antibody) BioAssayTM ELISA Kit (Human) discontinued
359505-01 48 Tests

TSHRAb (Thyroid Stimulating Hormone Receptor Antibody) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
TSHRAb (Thyroid Stimulating Hormone Receptor Antibody) BioAssayTM ELISA Kit (Human) discontinued
359505-02 96 Tests

TSHRAb (Thyroid Stimulating Hormone Receptor Antibody) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
OR4M1 Polyclonal Antibody
RA33849-01 50 µL

OR4M1 Polyclonal Antibody

Sign In for Pricing
View Details
OR4M1 Polyclonal Antibody
RA33849-02 100 µL

OR4M1 Polyclonal Antibody

Sign In for Pricing
View Details