Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DUX4 protein

This Human DUX4 protein spans the amino acid sequence from region 327-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Double homeobox protein 10

UniProt

Q9UBX2

Expression Region

327-424aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMM1 (Phosphomannomutase 1, Sec53, PMMH-22, Brain Glucose-1,6-Bisphosphatase)
364700 200 µL

PMM1 (Phosphomannomutase 1, Sec53, PMMH-22, Brain Glucose-1,6-Bisphosphatase)

Sign In for Pricing
View Details
Rat Myelin Oligodendrocyte Glycoprotein (MOG) ELISA Kit
DLR-MOG-Ra-48T 48 Tests

Rat Myelin Oligodendrocyte Glycoprotein (MOG) ELISA Kit

Sign In for Pricing
View Details
VGLUT2 Antibody
MBS804171-01 0.1 mg

VGLUT2 Antibody

Sign In for Pricing
View Details
VGLUT2 Antibody
MBS804171-02 5x 0.1 mg

VGLUT2 Antibody

Sign In for Pricing
View Details
Cavy N-Acetylated-Alpha-Linked Acidic Dipeptidase 2 (NAALAD2) ELISA Kit
MBS9348357 Inquire

Cavy N-Acetylated-Alpha-Linked Acidic Dipeptidase 2 (NAALAD2) ELISA Kit

Sign In for Pricing
View Details
HPRT (B-11) P
sc-393901 P 100 µg - 0.5 mL

HPRT (B-11) P

Sign In for Pricing
View Details