Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Influenza B virus Non-structural protein 1 protein

This Influenza B virus Non-structural protein 1 protein spans the amino acid sequence from region 1-281aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NS1A

UniProt

P12600

Expression Region

1-281aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Influenza B virus (strain B/Singapore/222/1979)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAENMTTTQIEVGPGATNATINFEAGILECYERLSWQRALDYPGQDRLNRLKRKLESRIKTHNKSEPESKRMSLEERKAIGVKMMKVLLFMNPSAGIEGFEPYCMKNFSNSNCPNYNWTDYPPTPGKCLDDIEEEPENVDDPTEIVLRDMNNKDARQKIKEEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGKFLKHPNGYKTLSTLHRLNVYDQSGRLVAKLVATDDLTVEDEEDGHRILNSLFERFNEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP6 Recombinant Monoclonal Antibody
CSB-RA065800A0HU-01 50 μL

CASP6 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
CASP6 Recombinant Monoclonal Antibody
CSB-RA065800A0HU-02 100 µL

CASP6 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Apratoxin B
orb1698363 25 mg

Apratoxin B

Sign In for Pricing
View Details
BACH1 (BTB and CNC Homology 1, BACH-1) (PE)
MBS6408059-01 0.1 mL

BACH1 (BTB and CNC Homology 1, BACH-1) (PE)

Sign In for Pricing
View Details
BACH1 (BTB and CNC Homology 1, BACH-1) (PE)
MBS6408059-02 5x 0.1 mL

BACH1 (BTB and CNC Homology 1, BACH-1) (PE)

Sign In for Pricing
View Details
SC-43 5mg
A22295-5 5 mg

SC-43 5mg

Sign In for Pricing
View Details