Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YscF protein

This yscF protein spans the amino acid sequence from region 1-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q2T727

Expression Region

1-89aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genesig Real-Time PCR detection kit for Taylorella equigenitalis, Standard
349550 1 Kit

Genesig Real-Time PCR detection kit for Taylorella equigenitalis, Standard

Sign In for Pricing
View Details
NR1H5P sgRNA CRISPR Lentivector (Human) (Target 2)
K1451703 1.0 µg DNA

NR1H5P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-AKAP 95/AKAP8 Antibody Picoband®, Dylight594 Conjugate
A05133-2-Dylight594 100 µg

Anti-AKAP 95/AKAP8 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Mouse Monoclonal REXO2 Antibody (59D9) [DyLight 650]
NBP2-42639C 100 µL

Mouse Monoclonal REXO2 Antibody (59D9) [DyLight 650]

Sign In for Pricing
View Details
Mouse Monoclonal Npas4 Antibody (S408-79) [DyLight 350]
NBP2-59332UV 100 µL

Mouse Monoclonal Npas4 Antibody (S408-79) [DyLight 350]

Sign In for Pricing
View Details
ZNF408 Rabbit Polyclonal Antibody (FITC)
orb2136334 100 µL

ZNF408 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details