Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-DRB1 protein

This Human HLA-DRB1 protein spans the amino acid sequence from region 31-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class II antigen DRB1*12 ; DR-12 ; DR12

UniProt

Q95IE3

Expression Region

31-266aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTRPRFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-mir-129-1 Vector
mh40134 500 ng

LentimiRa-hsa-mir-129-1 Vector

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae rplS Protein (aa 1-121) (strain 232)
VAng-Lsx06565-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Hyopneumoniae rplS Protein (aa 1-121) (strain 232)

Sign In for Pricing
View Details
Chk2 polyclonal antibody
orb646662-01 50 μL

Chk2 polyclonal antibody

Sign In for Pricing
View Details
Chk2 polyclonal antibody
orb646662-02 100 µL

Chk2 polyclonal antibody

Sign In for Pricing
View Details
Chk2 polyclonal antibody
orb646662-03 200 µL

Chk2 polyclonal antibody

Sign In for Pricing
View Details
Human anti-nuclear factor Antibody, ANF ELISA Kit
MBS9301233-01 48 Well

Human anti-nuclear factor Antibody, ANF ELISA Kit

Sign In for Pricing
View Details