Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-DRB1 protein

This Human HLA-DRB1 protein spans the amino acid sequence from region 31-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class II antigen DRB1*12 ; DR-12 ; DR12

UniProt

Q95IE3

Expression Region

31-266aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTRPRFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Masp1 AAV siRNA Pooled Vector
28134166 1.0 µg

Masp1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ABI3BP (NM_015429) Human Tagged ORF Clone Lentiviral Particle
RC206414L3V 200 µL

ABI3BP (NM_015429) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse CD8A ELISA Kit
E047781 1 Each

Mouse CD8A ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TrkB /NTRK2 Protein, C-His (Active)
AHH31802 100 μg

Recombinant Human TrkB /NTRK2 Protein, C-His (Active)

Sign In for Pricing
View Details
PA2G4 Antibody / EBP1 / ErbB3-binding protein 1
F54781-0.4ML 0.4 mL

PA2G4 Antibody / EBP1 / ErbB3-binding protein 1

Sign In for Pricing
View Details
ZN358 rabbit pAb
MBS8597686-01 0.1 mL

ZN358 rabbit pAb

Sign In for Pricing
View Details