Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPA17 protein

This Human SPA17 protein spans the amino acid sequence from region 1-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 22 ; CT22Sp17-1Sperm autoantigenic protein 17 ; Sperm protein 17

UniProt

Q15506

Expression Region

1-146aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emcn sgRNA CRISPR Lentivector (Rat) (Target 1)
K7425202 1.0 µg DNA

Emcn sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
RHXF2 rabbit pAb
ES10179-01 50 µL

RHXF2 rabbit pAb

Sign In for Pricing
View Details
RHXF2 rabbit pAb
ES10179-02 100 µL

RHXF2 rabbit pAb

Sign In for Pricing
View Details
ALK5-IN-8
BA9158-25 25 mg

ALK5-IN-8

Sign In for Pricing
View Details
BDP® 630/650 azide, 50 mg
55430 50 mg

BDP® 630/650 azide, 50 mg

Sign In for Pricing
View Details
Mouse recombinant SPARC protein
PROTP07214-50ug 50 µg

Mouse recombinant SPARC protein

Sign In for Pricing
View Details