Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF-21 protein

This Human FGF-21 protein spans the amino acid sequence from region 29-209. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

/

UniProt

Q9NSA1

Expression Region

29-209

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPA17 Antibody
KC-8382-01 50 μL

SPA17 Antibody

Sign In for Pricing
View Details
SPA17 Antibody
KC-8382-02 100 µL

SPA17 Antibody

Sign In for Pricing
View Details
SPA17 Antibody
KC-8382-03 1 mL

SPA17 Antibody

Sign In for Pricing
View Details
Z-FA-FMK
TRC-Z350000-25MG 25 mg

Z-FA-FMK

Sign In for Pricing
View Details
MIR1470 Human qPCR Primer Pair (MI0007075)
HP300164 200 Reactions

MIR1470 Human qPCR Primer Pair (MI0007075)

Sign In for Pricing
View Details
SCGB3A2 Human qPCR Primer Pair (NM_054023)
HP216611 200 Reactions

SCGB3A2 Human qPCR Primer Pair (NM_054023)

Sign In for Pricing
View Details