Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DDX39B protein

This Human DDX39B protein spans the amino acid sequence from region 2-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

56KDA U2AF65-associated protein; ATP-dependent RNA helicase p47DEAD box protein UAP56HLA-B-associated transcript 1 protein

UniProt

Q13838

Expression Region

2-251aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9 Antibody (Center) [APR03866G]
APR03866G-01 50 µL

C9 Antibody (Center) [APR03866G]

Sign In for Pricing
View Details
C9 Antibody (Center) [APR03866G]
APR03866G-02 100 µL

C9 Antibody (Center) [APR03866G]

Sign In for Pricing
View Details
C9 Antibody (Center) [APR03866G]
APR03866G-03 200 µL

C9 Antibody (Center) [APR03866G]

Sign In for Pricing
View Details
C9 Antibody (Center) [APR03866G]
APR03866G-04 400 µL

C9 Antibody (Center) [APR03866G]

Sign In for Pricing
View Details
NAT2 Protein Vector (Mouse) (pPB-N-His)
PV204175 500 ng

NAT2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Multiplex Assay Kit for Growth Differentiation Factor 15 (GDF15), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0028897 96 Tests

Multiplex Assay Kit for Growth Differentiation Factor 15 (GDF15), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details