Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL13 protein

This Human IL13 protein spans the amino acid sequence from region 21-132aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13

UniProt

P35225

Expression Region

21-132aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvin alpha (PARVA) Mouse Monoclonal Antibody [Clone ID: LBI3H2]
AMM13609V 100 µL

Parvin alpha (PARVA) Mouse Monoclonal Antibody [Clone ID: LBI3H2]

Sign In for Pricing
View Details
Ifnz sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3318304 1.0 µg DNA

Ifnz sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
AHR-5645B fumarate
MBS5814128 Inquire

AHR-5645B fumarate

Sign In for Pricing
View Details
Mannose-1-phosphate guanyltransferase β (GMPPB) Human ELISA Kit
E8426 96 Tests

Mannose-1-phosphate guanyltransferase β (GMPPB) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Neorickettsia sennetsu Protein-export protein SecB (secB)
MBS1381732-01 0.02 mg (E-Coli)

Recombinant Neorickettsia sennetsu Protein-export protein SecB (secB)

Sign In for Pricing
View Details
Recombinant Neorickettsia sennetsu Protein-export protein SecB (secB)
MBS1381732-02 0.1 mg (E-Coli)

Recombinant Neorickettsia sennetsu Protein-export protein SecB (secB)

Sign In for Pricing
View Details