Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL13 protein

This Human IL13 protein spans the amino acid sequence from region 21-132aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13

UniProt

P35225

Expression Region

21-132aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-mir-1963 Virus
mm0186 1.0 mL

AdmiRa-mmu-mir-1963 Virus

Sign In for Pricing
View Details
Pigeon Delta Like Protein 4 ELISA Kit
MBS057023 Inquire

Pigeon Delta Like Protein 4 ELISA Kit

Sign In for Pricing
View Details
FAM150A siRNA (Human)
CRJ7894-01 15 nmol

FAM150A siRNA (Human)

Sign In for Pricing
View Details
FAM150A siRNA (Human)
CRJ7894-02 30 nmol

FAM150A siRNA (Human)

Sign In for Pricing
View Details
LIM domain Kinase 2 (LIMK2) Chicken ELISA Kit
E6923 96 Tests

LIM domain Kinase 2 (LIMK2) Chicken ELISA Kit

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), 1mg/mL
BNUM1041-50 1x 50 µL

TRIM29 (TRIM29/1041), 1mg/mL

Sign In for Pricing
View Details