Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human WISP2 protein

This Human WISP2 protein spans the amino acid sequence from region 1-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCN family member 5 Connective tissue growth factor-like protein

UniProt

O76076

Expression Region

1-250aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXNA3 Antibody
orb1259740 100 µL

PLXNA3 Antibody

Sign In for Pricing
View Details
UvrB Antibody
orb834950 2 mg

UvrB Antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)
MBS2143309-01 0.1 mL

FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)
MBS2143309-02 0.2 mL

FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)
MBS2143309-03 0.5 mL

FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)
MBS2143309-04 1 mL

FITC-Linked Polyclonal Antibody to Stem Cell Factor (SCF)

Sign In for Pricing
View Details