Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PSCA protein

This Human PSCA protein spans the amino acid sequence from region 13-86aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PSCA, UNQ206/PRO232, Prostate stem cell antigen

UniProt

O43653

Expression Region

13-86aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-Mettl13-shRNA3-Puro Plasmid
PVT67668 2 µg

PLV3-U6-Mettl13-shRNA3-Puro Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal ACBD3 Antibody (OTI3A1) [Alexa Fluor 532]
NBP2-72149AF532 0.1 mL

Mouse Monoclonal ACBD3 Antibody (OTI3A1) [Alexa Fluor 532]

Sign In for Pricing
View Details
EIF4H sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
19175111 3x 1.0 µg

EIF4H sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral mouse Psen1 shRNA (UAS) - Lentiviral mouse Psen1 shRNA (UAS, iRFP) (25)
GTR15135710 1 Vial

Lentiviral mouse Psen1 shRNA (UAS) - Lentiviral mouse Psen1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-Hu CD112 Purified
11-777-C025 0.025 mg

Anti-Hu CD112 Purified

Sign In for Pricing
View Details
Anti-Human CPOX Polyclonal Antibody
HD588014-01 50 µg

Anti-Human CPOX Polyclonal Antibody

Sign In for Pricing
View Details