Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OSM protein

This Human OSM protein spans the amino acid sequence from region 26-221aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name:OSM

UniProt

P13725

Expression Region

26-221aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin-Linked Kinase (ILK) (Western Blot Control)
MBS343046-01 0.01 mg

Integrin-Linked Kinase (ILK) (Western Blot Control)

Sign In for Pricing
View Details
Integrin-Linked Kinase (ILK) (Western Blot Control)
MBS343046-02 5x 0.01 mg

Integrin-Linked Kinase (ILK) (Western Blot Control)

Sign In for Pricing
View Details
SOX11 Antibody
58-294 400 µL

SOX11 Antibody

Sign In for Pricing
View Details
Aknad1 Rat shRNA Plasmid (Locus ID 691416)
TL703752 1 Kit

Aknad1 Rat shRNA Plasmid (Locus ID 691416)

Sign In for Pricing
View Details
Rbfox1 (NM_001106974) Rat Tagged ORF Clone Lentiviral Particle
RR213164L3V 200 µL

Rbfox1 (NM_001106974) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Porcine Trappin 2 ELISA kit
GTR10398686 96 Well

Porcine Trappin 2 ELISA kit

Sign In for Pricing
View Details