Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FABP5 protein

This Human FABP5 protein spans the amino acid sequence from region 1-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epidermal-type fatty acid-binding protein

UniProt

Q01469

Expression Region

1-135aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON3 Polyclonal Antibody, PerCP Conjugated
bs-11782R-PerCP 100 µL

PON3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Pank2 Rat Pre-designed siRNA Set A
HY-RS27529 1 Set

Pank2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
NTN3 Rabbit Polyclonal Antibody (BF594)
orb2548068 100 µL

NTN3 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
MYNN Antibody
orb1319408-01 30 µL

MYNN Antibody

Sign In for Pricing
View Details
MYNN Antibody
orb1319408-02 50 μL

MYNN Antibody

Sign In for Pricing
View Details
MYNN Antibody
orb1319408-03 100 µL

MYNN Antibody

Sign In for Pricing
View Details