Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human coronavirus NL63 Nucleo protein

This Human coronavirus NL63 Nucleo protein spans the amino acid sequence from region 1-377aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Nucleocapsid protein) (NC) (Protein N)

UniProt

Q6Q1R8

Expression Region

1-377aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human coronavirus NL63 (HCoV-NL63)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

48.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASVNWADDRAARKKFPPPSFYMPLLVSSDKAPYRVIPRNLVPIGKGNKDEQIGYWNVQERWRMRRGQRVDLPPKVHFYYLGTGPHKDLKFRQRSDGVVWVAKEGAKTVNTSLGNRKRNQKPLEPKFSIALPPELSVVEFEDRSNNSSRASSRSSTRNNSRDSSRSTSRQQSRTRSDSNQSSSDLVAAVTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQCFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSEVSTDEVGDNVQITYTYKMLVAKDNKNLPKFIEQISAFTKPSSIKEMQSQSSHVAQNTVLNASIPESKPLADDDSAIIEIVNEVLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS4 Rabbit Polyclonal Antibody
TA372420 100 µL

DHRS4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL-12 p40 Antibody Pair Set
E-KAB-0580 50 µL & 100 µg

Mouse IL-12 p40 Antibody Pair Set

Sign In for Pricing
View Details
Recombinant FOXO4 Monoclonal Antibody
E-AB-81558-01 50 µL

Recombinant FOXO4 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant FOXO4 Monoclonal Antibody
E-AB-81558-02 100 µL

Recombinant FOXO4 Monoclonal Antibody

Sign In for Pricing
View Details
Human USP42 activation kit by CRISPRa
GA113384 1 Kit

Human USP42 activation kit by CRISPRa

Sign In for Pricing
View Details
BAX Rabbit Polyclonal Antibody
TA373934 100 µL

BAX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details