Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NSP8 protein

This Human NSP8 protein spans the amino acid sequence from region 16-121aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0DTC8

Expression Region

16-121aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cresyl Violet (Acetate) 70% Dye Content For Microscopy
00892 00005 5 g

Cresyl Violet (Acetate) 70% Dye Content For Microscopy

Sign In for Pricing
View Details
(1R,2R) -Cyclohexane-1,2-diamine
HY-76211A 1 Each

(1R,2R) -Cyclohexane-1,2-diamine

Sign In for Pricing
View Details
2-Aminobenzenesulfonic acid
C11552-25mg 25 mg

2-Aminobenzenesulfonic acid

Sign In for Pricing
View Details
MCM5 Polyclonal Antibody
E-AB-61010-01 60 µL

MCM5 Polyclonal Antibody

Sign In for Pricing
View Details
MCM5 Polyclonal Antibody
E-AB-61010-02 120 µL

MCM5 Polyclonal Antibody

Sign In for Pricing
View Details
MCM5 Polyclonal Antibody
E-AB-61010-03 200 µL

MCM5 Polyclonal Antibody

Sign In for Pricing
View Details