Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Transmembrane protease serine 2 protein

This Human Transmembrane protease serine 2 protein spans the amino acid sequence from region 256-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Serine protease 10) (PRSS10)

UniProt

O15393

Expression Region

256-492aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

53.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF740 conjugate, 0.1mg/mL
BNC743339-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant EIF4EBP1 (phospho T46) Antibody
RC-6955-01 50 μL

Recombinant EIF4EBP1 (phospho T46) Antibody

Sign In for Pricing
View Details
Recombinant EIF4EBP1 (phospho T46) Antibody
RC-6955-02 100 µL

Recombinant EIF4EBP1 (phospho T46) Antibody

Sign In for Pricing
View Details
Recombinant EIF4EBP1 (phospho T46) Antibody
RC-6955-03 1 mL

Recombinant EIF4EBP1 (phospho T46) Antibody

Sign In for Pricing
View Details
MAPK6 Mouse Monoclonal Antibody [Clone ID: 4E8]
AM06607SU-N 100 µL

MAPK6 Mouse Monoclonal Antibody [Clone ID: 4E8]

Sign In for Pricing
View Details
CELF3 (N-term) Rabbit Polyclonal Antibody
AP54327PU-N 400 µL

CELF3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details