Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein
This Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Non-structural protein 9
UniProt
P0DTD1
Expression Region
4141-4253aa
Tag
C-terminal hFc1-Flag-tagged
Source
Mammalian cell
Origin
Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Field of Research
Respiratory Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
44.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Coronavirus-Host Interactome Targets Proteins
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942981-100 1x 100 µL
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942224-500 1x 500 µL
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940698-500 1x 500 µL
Chromogranin A (LK2H10 + PHE5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741099-500 1x 500 µL
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680970-100 1x 100 µL
GLG1 (Golgi Complex) (GLG1/970), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details