Human Novel Coronavirus Spike glycoprotein (S) protein
This Human Novel Coronavirus Spike glycoprotein (S) protein spans the amino acid sequence from region 319-541aa (V483A) . Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
UniProt
P0DTC2
Expression Region
319-541aa (V483A)
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Field of Research
Microbiology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 μg/ml can bind human ACE2, the EC50 is 196.4-272.1 ng/ml. 2Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 μg/ml can bind SARS-CoV-2-S Antibody, the EC50 is 7.481- 18.76 ng/ml.
Form
Lyophilized powder
Molecular Weight
27.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
SARS-CoV-2 Related Proteins
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
AA Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471077-100 1x 100 µL
Cytokeratin, LMW (KRTL/1077), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942550-100 1x 100 µL
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681060-100 1x 100 µL
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 