Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Novel Coronavirus Spike glycoprotein (S) protein

This Human Novel Coronavirus Spike glycoprotein (S) protein spans the amino acid sequence from region 319-541aa (V483A) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0DTC2

Expression Region

319-541aa (V483A)

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Field of Research

Microbiology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 μg/ml can bind human ACE2, the EC50 is 196.4-272.1 ng/ml. 2Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 μg/ml can bind SARS-CoV-2-S Antibody, the EC50 is 7.481- 18.76 ng/ml.

Form

Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

SARS-CoV-2 Related Proteins

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nystose Trihydrate
TRC-N489153-250MG 250 mg

Nystose Trihydrate

Sign In for Pricing
View Details
CXCL16 Antibody
KC-2752-01 50 μL

CXCL16 Antibody

Sign In for Pricing
View Details
CXCL16 Antibody
KC-2752-02 100 µL

CXCL16 Antibody

Sign In for Pricing
View Details
CXCL16 Antibody
KC-2752-03 1 mL

CXCL16 Antibody

Sign In for Pricing
View Details
Recombinant Mouse HER2/ErbB2 Protein (Fc Tag)
PKSM040282 100 µg

Recombinant Mouse HER2/ErbB2 Protein (Fc Tag)

Sign In for Pricing
View Details
FOXO4 Rabbit Polyclonal Antibody
AP02683PU-S 50 µL

FOXO4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details