Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human JAG1 protein

This Human JAG1 protein spans the amino acid sequence from region 185-334aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD339

UniProt

P78504

Expression Region

185-334aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CellExp™ CD27 / TNFRSF7, Fc Tag, Cynomolgus / Rhesus macaque Recombinant
P1407-50 50 µg

Human CellExp™ CD27 / TNFRSF7, Fc Tag, Cynomolgus / Rhesus macaque Recombinant

Sign In for Pricing
View Details
CFL1 Antibody
orb677416 100 µL

CFL1 Antibody

Sign In for Pricing
View Details
hsa-miR-887-3p miRNA Mimic
MBS8298717-01 5 nmol

hsa-miR-887-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-887-3p miRNA Mimic
MBS8298717-02 10 nmol

hsa-miR-887-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-887-3p miRNA Mimic
MBS8298717-03 5x 10 nmol

hsa-miR-887-3p miRNA Mimic

Sign In for Pricing
View Details
Lentiviral human HTRA3 shRNA (UAS) - Lentiviral human HTRA3 shRNA (UAS, GFP) (25)
GTR15094436 1 Vial

Lentiviral human HTRA3 shRNA (UAS) - Lentiviral human HTRA3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details