Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DNASE1L3 protein

This Human DNASE1L3 protein spans the amino acid sequence from region 21-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3) (Liver and spleen DNase)

UniProt

Q13609

Expression Region

21-305aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde
PC1019408-01 250 mg

2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde

Sign In for Pricing
View Details
2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde
PC1019408-02 500 mg

2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde

Sign In for Pricing
View Details
2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde
PC1019408-03 1 g

2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde

Sign In for Pricing
View Details
2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde
PC1019408-04 5 g

2- (Methoxymethyl) -5- (trifluoromethyl) benzaldehyde

Sign In for Pricing
View Details
ADIG Recombinant Protein (Mouse)
RP114521 100 µg

ADIG Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human Esophagus PrimaCell™1: Normal Esophageal Epithelial Cells
2-96055 1 Kit

Human Esophagus PrimaCell™1: Normal Esophageal Epithelial Cells

Sign In for Pricing
View Details