Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Lqhb1 protein

This Animal Lqhb1 protein spans the amino acid sequence from region 20-85aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lqh-beta-1

UniProt

P0C5H3

Expression Region

20-85aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DNGYLLNKATGCKVWCVINNASCNSECKLRRGNYGYCYFWKLACYCEGAPKSELWAYATNKCNGKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (4-Bromobenzoyl) -acrylic acid
FB67544-01 5 g

3- (4-Bromobenzoyl) -acrylic acid

Sign In for Pricing
View Details
3- (4-Bromobenzoyl) -acrylic acid
FB67544-02 10 g

3- (4-Bromobenzoyl) -acrylic acid

Sign In for Pricing
View Details
3- (4-Bromobenzoyl) -acrylic acid
FB67544-03 25 g

3- (4-Bromobenzoyl) -acrylic acid

Sign In for Pricing
View Details
TBX6 antibody
70R-20729 50 μL

TBX6 antibody

Sign In for Pricing
View Details
Zymogram Renaturation Buffer 10X
42620001-2 500 mL

Zymogram Renaturation Buffer 10X

Sign In for Pricing
View Details
C17orf70 antibody - N-terminal region (ARP62554_P050)
ARP62554_P050 100 µL

C17orf70 antibody - N-terminal region (ARP62554_P050)

Sign In for Pricing
View Details