Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant EPFL9 protein

This Plant EPFL9 protein spans the amino acid sequence from region 32-102aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPF-like protein 9

UniProt

Q9SV72

Expression Region

32-102aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-kB p65 (RELA) Rabbit Polyclonal Antibody
AP02553PU-N 100 µL

NF-kB p65 (RELA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FFPE RNA Purification 96-Well Kit
25400 2 Plates

FFPE RNA Purification 96-Well Kit

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), Biotin conjugate, 0.1mg/mL
BNCB1880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF640R conjugate, 0.1mg/mL
BNC401091-100 1x 100 µL

PS2 (TFF1/1091), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PKC delta (PRKCD) Rabbit Polyclonal Antibody
AP20759PU-N 100 µg

PKC delta (PRKCD) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Adipose tissue
CS800628 5x 5 µm

Tissue FFPE Sections, Adipose tissue

Sign In for Pricing
View Details