Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant EPFL9 protein

This Plant EPFL9 protein spans the amino acid sequence from region 32-102aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPF-like protein 9

UniProt

Q9SV72

Expression Region

32-102aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12 Ceramide
TRC-C262770-1MG 1 mg

C12 Ceramide

Sign In for Pricing
View Details
DYNLL2 Antibody
8C15514-AAT 50 µg

DYNLL2 Antibody

Sign In for Pricing
View Details
ZNF395 Antibody
KC-28719-01 50 μL

ZNF395 Antibody

Sign In for Pricing
View Details
ZNF395 Antibody
KC-28719-02 100 µL

ZNF395 Antibody

Sign In for Pricing
View Details
ZNF395 Antibody
KC-28719-03 1 mL

ZNF395 Antibody

Sign In for Pricing
View Details
Mix-n-StainTM CF®740 Antibody Labeling Kit, 1x (5-20ug) labeling
#92576 1 Kit

Mix-n-StainTM CF®740 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details