Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCGB2A2 protein

This Human SCGB2A2 protein spans the amino acid sequence from region 19-93aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mammaglobin-1 (Secretoglobin family 2A member 2)

UniProt

Q13296

Expression Region

19-93aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hspb1 (NM_013560) Mouse Untagged Clone
MC203704 10 µg

Hspb1 (NM_013560) Mouse Untagged Clone

Sign In for Pricing
View Details
HGPR20 full length protein-synthetic nanodisc
orb2708004-01 10 µg

HGPR20 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
HGPR20 full length protein-synthetic nanodisc
orb2708004-02 50 µg

HGPR20 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Cyclin M2 (h) -PR
sc-77061-PR 10 µM - 20 µL

Cyclin M2 (h) -PR

Sign In for Pricing
View Details
Plce1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7549608 1.0 µg DNA

Plce1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
N-Nitroso Esomeprazole Impurity A
CS-O-42659 1 Each

N-Nitroso Esomeprazole Impurity A

Sign In for Pricing
View Details