Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Lqh7 protein

This Animal Lqh7 protein spans the amino acid sequence from region 1-66aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lqh VII (LqhVII)

UniProt

P59357

Expression Region

1-66aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRDGYIAKPENCAHHCFPGSSGCDTLCKENGGTGGHCGFKVGHGTACWCNALPDKVGIIVDGVKCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal C19orf47 Antibody
NBP2-99262-50ul 50 µL

Rabbit Polyclonal C19orf47 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal pan Actin Antibody (HHF35) [Alexa Fluor 750]
NBP2-34634AF750 0.1 mL

Mouse Monoclonal pan Actin Antibody (HHF35) [Alexa Fluor 750]

Sign In for Pricing
View Details
NAD+
B1793-5000 5 g

NAD+

Sign In for Pricing
View Details
DHX29 sgRNA CRISPR Lentivector (Human) (Target 2)
K0600603 1.0 µg DNA

DHX29 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Al2O3-B SPE Cartridges1g/6ml
SPEB00ALB061000A 30 Pieces/Case:30 Pieces/ PACKS:1 PACKS/CASE

Al2O3-B SPE Cartridges1g/6ml

Sign In for Pricing
View Details
C15orf56 (NM_001039905) Human Untagged Clone
SC311084 10 µg

C15orf56 (NM_001039905) Human Untagged Clone

Sign In for Pricing
View Details