Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Lqh7 protein

This Animal Lqh7 protein spans the amino acid sequence from region 1-66aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lqh VII (LqhVII)

UniProt

P59357

Expression Region

1-66aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRDGYIAKPENCAHHCFPGSSGCDTLCKENGGTGGHCGFKVGHGTACWCNALPDKVGIIVDGVKCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXX1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-14125R-APC-Cy5.5 100 µL

CXX1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
ELISA Kit for Vascular Endothelial Growth Factor Receptor 2 (VEGFR2)
TRV-0002285 96 Well Plate

ELISA Kit for Vascular Endothelial Growth Factor Receptor 2 (VEGFR2)

Sign In for Pricing
View Details
Paxillin Polyclonal Antibody
RA28548-01 50 µL

Paxillin Polyclonal Antibody

Sign In for Pricing
View Details
Paxillin Polyclonal Antibody
RA28548-02 100 µL

Paxillin Polyclonal Antibody

Sign In for Pricing
View Details
Complement C1q Tumor Necrosis Factor-Related Protein 2 (C1QTNF2) Antibody
abx031301-01 80 µL

Complement C1q Tumor Necrosis Factor-Related Protein 2 (C1QTNF2) Antibody

Sign In for Pricing
View Details
Complement C1q Tumor Necrosis Factor-Related Protein 2 (C1QTNF2) Antibody
abx031301-02 400 µL

Complement C1q Tumor Necrosis Factor-Related Protein 2 (C1QTNF2) Antibody

Sign In for Pricing
View Details