Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ly6k protein

This Mouse Ly6k protein spans the amino acid sequence from region 21-123aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6K

UniProt

Q9CWP4

Expression Region

21-123aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTCHVCEAQNSYACSNPSQCPGEKKFCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLIEKPMPFLFYKCCQWDSCNGEGPPTDQLLKEQPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDNF/Brain-derived neurotrophic factor
MBS8532860-01 0.01 mg

BDNF/Brain-derived neurotrophic factor

Sign In for Pricing
View Details
BDNF/Brain-derived neurotrophic factor
MBS8532860-02 5x 0.01 mg

BDNF/Brain-derived neurotrophic factor

Sign In for Pricing
View Details
CHI Assay Kit (Spectrophotometry)
CB0048S 50 Tests

CHI Assay Kit (Spectrophotometry)

Sign In for Pricing
View Details
PCDH-CMV-HINT2EF1A-EGFP-T2A-PURO
BZ0989-2 1 Vial

PCDH-CMV-HINT2EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
Nucleic Acid Test Strip no cassette
WLFS8206 48 Tests/Box

Nucleic Acid Test Strip no cassette

Sign In for Pricing
View Details
Hotblock Dual LED Digital Dry Bath With Heating Blocks for 1.5ml (E11363) & 2.0ml (E11364) - ABDOS
E11390 1 Unit/Pack

Hotblock Dual LED Digital Dry Bath With Heating Blocks for 1.5ml (E11363) & 2.0ml (E11364) - ABDOS

Sign In for Pricing
View Details