Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Neu2 protein

This Mouse Neu2 protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytosolic sialidase (Mouse skeletal muscle sialidase) (MSS) (Murine thymic sialidase) (MTS) (N-acetyl-alpha-neuraminidase 2)

UniProt

Q9JMH3

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATCPVLQKETLFRTGVHAYRIPALLYLKKQKTLLAFAEKRASKTDEHAELIVLRRGSYNEATNRVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEHHQLHTKVNVTRLCCVSSTDHGRTWSPIQDLTETTIGSTHQEWATFAVGPGHCLQLRNPAGSLLVPAYAYRKLHPAQKPTPFAFCFISLDHGHTWKLGNFVAENSLECQVAEVGTGAQRMVYLNARSFLGARVQAQSPNDGLDFQDNRVVSKLVEPPHGCHGSVVAFHNPISKPHALDTWLLYTHPTDSRNRTNLGVYLNQMPLDPTAWSEPTLLAMGICAYSDLQNMGQGPDGSPQFGCLYESGNYEEIIFLIFTLKQAFPTVFDAQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm7861 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3336506 1.0 µg DNA

Gm7861 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Defb25 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3142003 1.0 µg DNA

Defb25 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)
MBS2081321-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)
MBS2081321-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)
MBS2081321-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)
MBS2081321-04 1 mL

Cy3-Linked Polyclonal Antibody to Chromatin Assembly Factor 1, Subunit B (CHAF1B)

Sign In for Pricing
View Details