Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria ipaB protein

This Bacteria ipaB protein spans the amino acid sequence from region 1-312aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

62 kDa antigen (CP0128)

UniProt

P18011

Expression Region

1-312aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG1 Isotype Control
abx405020 0.5 mg

Rat IgG1 Isotype Control

Sign In for Pricing
View Details
FAM40B/STRIP2 Rabbit Polyclonal Antibody (APC)
orb2580943 100 µg

FAM40B/STRIP2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Lentiviral human DNAAF4 sgRNA gene knockout kit - Lentiviral human DNAAF4 sgRNA gene knockout kit (plasmid)
GTR15370907 1 Vial

Lentiviral human DNAAF4 sgRNA gene knockout kit - Lentiviral human DNAAF4 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
LRG1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
27592154 3x 1.0 µg DNA

LRG1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)
MBS2095648-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)
MBS2095648-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Ephrin A4 (EFNA4)

Sign In for Pricing
View Details