Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus UL99 protein

This Virus UL99 protein spans the amino acid sequence from region 2-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

28KDA structural phosphoprotein pp28

UniProt

P13200

Expression Region

2-190aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit
MBS943605-01 24 Well (LIMIT 1)

Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit

Sign In for Pricing
View Details
Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit
MBS943605-02 48 Well

Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit

Sign In for Pricing
View Details
Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit
MBS943605-03 96 Well

Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit

Sign In for Pricing
View Details
Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit
MBS943605-04 5x 96 Well

Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit

Sign In for Pricing
View Details
Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit
MBS943605-05 10x 96 Well

Human Programmed cell death 6-interacting protein, PDCD6IP ELISA Kit

Sign In for Pricing
View Details
ZC3H12B Antibody
5675-002mg 0.02 mg

ZC3H12B Antibody

Sign In for Pricing
View Details