Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LGALS7 protein

This Human LGALS7 protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HKL-14PI7p53-induced gene 1 protein

UniProt

P47929

Expression Region

2-136aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLink™ xtra Rapid iFluor® 647 Antibody Labeling Kit *BSA-Compatible*
1963-AAT 2 Labelings

ReadiLink™ xtra Rapid iFluor® 647 Antibody Labeling Kit *BSA-Compatible*

Sign In for Pricing
View Details
Diethyl Ethylmalonate
TRC-D444305-50G 50 g

Diethyl Ethylmalonate

Sign In for Pricing
View Details
2’-Deoxy-3’,5’-di-O-benzoyl-2’,2’-difluorocytidine
TRC-D232665-1G 1 g

2’-Deoxy-3’,5’-di-O-benzoyl-2’,2’-difluorocytidine

Sign In for Pricing
View Details
W 54011
TRC-W400130-1MG 1 mg

W 54011

Sign In for Pricing
View Details
Recombinant Human UROD Protein (His Tag)
PKSH033199-01 10 µg

Recombinant Human UROD Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human UROD Protein (His Tag)
PKSH033199-02 50 µg

Recombinant Human UROD Protein (His Tag)

Sign In for Pricing
View Details