Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD48 protein

This Human CD48 protein spans the amino acid sequence from region 27-220aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-lymphocyte activation marker BLAST-1 (BCM1 surface antigen) (Leukocyte antigen MEM-102) (SLAM family member 2) (SLAMF2) (Signaling lymphocytic activation molecule 2) (TCT.1) (CD48) (BCM1) (BLAST1)

UniProt

P09326

Expression Region

27-220aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized CD48 at 2 μg/ml can bind Anti-CD48 rabbit monoclonal antibody, the EC50 of human CD48 protein is 0.5806-0.8463 ng/ml.

Form

Lyophilized powder

Molecular Weight

51.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 Rabbit Polyclonal Antibody (FITC)
orb360826 100 µg

ROR2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CSRP1 siRNA (Rat)
orb1832860-01 15 nmol

CSRP1 siRNA (Rat)

Sign In for Pricing
View Details
CSRP1 siRNA (Rat)
orb1832860-02 30 nmol

CSRP1 siRNA (Rat)

Sign In for Pricing
View Details
mmu-miR-301a miRNA Antagomir
MNM01643 2x 5.0 nmol

mmu-miR-301a miRNA Antagomir

Sign In for Pricing
View Details
Human F-Box Protein 32 (FBXO32) ELISA Kit
YP-W17178-01 48 Tests

Human F-Box Protein 32 (FBXO32) ELISA Kit

Sign In for Pricing
View Details
Human F-Box Protein 32 (FBXO32) ELISA Kit
YP-W17178-02 96 Tests

Human F-Box Protein 32 (FBXO32) ELISA Kit

Sign In for Pricing
View Details