Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD33 protein

This Human CD33 protein spans the amino acid sequence from region 18-259aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sialic acid-binding Ig-like lectin 3 (Siglec-3) (gp67) (CD33) (SIGLEC3)

UniProt

P20138

Expression Region

18-259aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized CD33 at 2 μg/ml can bind Anti-CD33 rabbit monoclonal antibody, the EC50 of human CD33 protein is 4.289- 5.312 ng/ml.

Form

Lyophilized powder

Molecular Weight

56.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Arginase (Arg) ELISA Kit
YP-W30529-01 48 Tests

Rat Arginase (Arg) ELISA Kit

Sign In for Pricing
View Details
Rat Arginase (Arg) ELISA Kit
YP-W30529-02 96 Tests

Rat Arginase (Arg) ELISA Kit

Sign In for Pricing
View Details
Cadmium Shot 99.999%
C00072 50 g

Cadmium Shot 99.999%

Sign In for Pricing
View Details
CSEN (Calsenilin, Kv Channel-interacting Protein 3, A-type Potassium Channel Modulatory Protein 3, DRE-antagonist Modulator, DREAM, KCNIP3, KChIP3, MGC18289) (AP) discontinued
125391-AP 100 µL

CSEN (Calsenilin, Kv Channel-interacting Protein 3, A-type Potassium Channel Modulatory Protein 3, DRE-antagonist Modulator, DREAM, KCNIP3, KChIP3, MGC18289) (AP) discontinued

Sign In for Pricing
View Details
UPF2 Antibody (Center)
MBS9212826-01 0.08 mL

UPF2 Antibody (Center)

Sign In for Pricing
View Details
UPF2 Antibody (Center)
MBS9212826-02 0.4 mL

UPF2 Antibody (Center)

Sign In for Pricing
View Details