Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BSG protein

This Human BSG protein spans the amino acid sequence from region 138-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5A11 antigen, 5F7, BASI_HUMAN, Basigin (Ok blood group), Basigin, Blood brain barrier HT7 antigen, Bsg, CD 147, CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M 6, M6, M6 leukocyte activation antigen, Neurothelin, OK, OK blood group, OK blood group antigen, TCSF, Tumor cell derived collagenase stimulatory factor, Tumor cell-derived collagenase stimulatory factor

UniProt

P35613

Expression Region

138-323aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Trpv2 shRNA (UAS) - Lentiviral mouse Trpv2 shRNA (UAS, RFP) plasmid
GTR15181837 1 Vial

Lentiviral mouse Trpv2 shRNA (UAS) - Lentiviral mouse Trpv2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
12a-Hydroxyrotenonic acid
orb1992443-01 1 mg

12a-Hydroxyrotenonic acid

Sign In for Pricing
View Details
12a-Hydroxyrotenonic acid
orb1992443-02 5 mg

12a-Hydroxyrotenonic acid

Sign In for Pricing
View Details
CDH3 (Cadherin-3) BioAssayTM ELISA Kit (Mouse) discontinued
354669-01 48 Tests

CDH3 (Cadherin-3) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
CDH3 (Cadherin-3) BioAssayTM ELISA Kit (Mouse) discontinued
354669-02 96 Tests

CDH3 (Cadherin-3) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
PD98059
C07586-10mg 10 mg

PD98059

Sign In for Pricing
View Details