Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant EPFL9 protein

This Plant EPFL9 protein spans the amino acid sequence from region 32-102aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPF-like protein 9 (EPFL9) (STOMAGEN) (At4g12970) (F25G13.60)

UniProt

Q9SV72

Expression Region

32-102aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ROCK2 Protein, N-His
orb2836966-01 20 µg

Recombinant Human ROCK2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ROCK2 Protein, N-His
orb2836966-02 50 µg

Recombinant Human ROCK2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ROCK2 Protein, N-His
orb2836966-03 100 µg

Recombinant Human ROCK2 Protein, N-His

Sign In for Pricing
View Details
MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog, MET18, MMS19L, hMMS19) (Biotin)
MBS6427026-01 0.1 mL

MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog, MET18, MMS19L, hMMS19) (Biotin)

Sign In for Pricing
View Details
MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog, MET18, MMS19L, hMMS19) (Biotin)
MBS6427026-02 5x 0.1 mL

MMS19 (MMS19 Nucleotide Excision Repair Protein Homolog, MET18, MMS19L, hMMS19) (Biotin)

Sign In for Pricing
View Details
HMX1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0974807 1.0 µg DNA

HMX1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details