Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP6V1F protein

This Human ATP6V1F protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

V-ATPase 14KDA subunitVacuolar proton pump subunit F

UniProt

Q16864

Expression Region

1-119aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin, beta (CTNNB1) (CTNNB1/2030R), CF640R conjugate, 0.1mg/mL
BNC402030-100 1x 100 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gel Crusher™ Spin Column
C6150 200 Units/Pack

Gel Crusher™ Spin Column

Sign In for Pricing
View Details
Histone H3 pSer10 Rabbit Polyclonal Antibody
AP12545PU-N 400 µL

Histone H3 pSer10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
[(Z)-Prop-1-enyl]phosphonic Acid (Technical Grade)
TRC-Z192700-5G 5 g

[(Z)-Prop-1-enyl]phosphonic Acid (Technical Grade)

Sign In for Pricing
View Details
Tissue Total RNA, Testis
CR561663 5 µg

Tissue Total RNA, Testis

Sign In for Pricing
View Details
3,4-Dihydroxybenzoic Acid 3-O-beta-D-Glucuronide
TRC-D451685-5MG 5 mg

3,4-Dihydroxybenzoic Acid 3-O-beta-D-Glucuronide

Sign In for Pricing
View Details