Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant Dau c 1 protein

This Plant Dau c 1 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CR16 (Pathogenesis-related protein Gea20) (Allergen, Dau c 1)

UniProt

O04298

Expression Region

1-154aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Daucus carota (Wild carrot)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAPGAYKSVEVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVIDGDILLGFIESIETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAMSTR sgRNA CRISPR Lentivector set (Human)
K1259401 3x 1.0 µg

MAMSTR sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
AGAP2 (Arf-GAP with GTPase, ANK Repeat and PH Domain-containing Protein 2, AGAP-2, Centaurin-gamma-1, Cnt-g1, GTP-binding and GTPase-activating Protein 2, GGAP2, Phosphatidylinositol-3-kinase Enhancer, PIKE, CENTG1, KIAA0167)
168009 100 µg

AGAP2 (Arf-GAP with GTPase, ANK Repeat and PH Domain-containing Protein 2, AGAP-2, Centaurin-gamma-1, Cnt-g1, GTP-binding and GTPase-activating Protein 2, GGAP2, Phosphatidylinositol-3-kinase Enhancer, PIKE, CENTG1, KIAA0167)

Sign In for Pricing
View Details
PGK1 (14) Alexa Fluor® 790
sc-130335 AF790 200 µg/mL

PGK1 (14) Alexa Fluor® 790

Sign In for Pricing
View Details
ACP1 Rabbit Polyclonal Antibody (FITC)
orb2122359 100 µL

ACP1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Xanthosine
JH147992 1 Each

Xanthosine

Sign In for Pricing
View Details
HPLC Column, C4,3μm,120Å,3.0x75mm
13021135 1 PC

HPLC Column, C4,3μm,120Å,3.0x75mm

Sign In for Pricing
View Details