Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus US11 protein

This Virus US11 protein spans the amino acid sequence from region 1-161aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vmw21

UniProt

P04487

Expression Region

1-161aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4BPA (NM_000715) Human Over-expression Lysate
LS000722-20ug 20 µg

C4BPA (NM_000715) Human Over-expression Lysate

Sign In for Pricing
View Details
Chromium (III) acetate
C04082 1 g

Chromium (III) acetate

Sign In for Pricing
View Details
(4-Amino-2-nitrophenyl) methanol
JH217135 1 Each

(4-Amino-2-nitrophenyl) methanol

Sign In for Pricing
View Details
ATJ72 Antibody
orb787163 2 mg

ATJ72 Antibody

Sign In for Pricing
View Details
Human ATM Pre-designed siRNA Set B
SI001224B 1 Each

Human ATM Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-FXR1 Antibody Picoband®, APC Conjugate
A03308-2-APC 100 µg/Vial

Anti-FXR1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details