Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus US11 protein

This Virus US11 protein spans the amino acid sequence from region 1-161aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vmw21

UniProt

P04487

Expression Region

1-161aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQTQPPAPVGPGDPDVYLKGVPSAGMHPRGVHAPRGHPRMISGPPQRGDNDQAAGQCGDSGLLRVGADTTISKPSEAVRPPTIPRTPRVPREPRVPRPPREPREPRVPRAPRDPRVPRDPRDPRQPRSPREPRSPREPRSPREPRTPRTPREPRTARGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody
MBS2563804-01 0.05 mL

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody
MBS2563804-02 0.1 mL

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody
MBS2563804-03 5x 0.1 mL

Anti-HIV-1 p24 Protein (group M, subtype B, strain 92418) Polyclonal Antibody

Sign In for Pricing
View Details
AVL9 Rabbit Polyclonal Antibody
orb258611 100 µg

AVL9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Endovion
MBS3843672-01 5 mg

Endovion

Sign In for Pricing
View Details
Endovion
MBS3843672-02 10 mg

Endovion

Sign In for Pricing
View Details