Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Nuclear export protein

This Virus Nuclear export protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NEP (Non-structural protein 2) (NS2)

UniProt

P08014

Expression Region

1-122aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Influenza B virus (strain B/Yamagata/1/1973)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpb1 CTD (Phospho Ser5) Antibody
A9748-01 50 μL

Rpb1 CTD (Phospho Ser5) Antibody

Sign In for Pricing
View Details
Rpb1 CTD (Phospho Ser5) Antibody
A9748-02 100 µL

Rpb1 CTD (Phospho Ser5) Antibody

Sign In for Pricing
View Details
Glucose 6-Phosphate Dehydrogenation
orb3073151-01 100 U

Glucose 6-Phosphate Dehydrogenation

Sign In for Pricing
View Details
Glucose 6-Phosphate Dehydrogenation
orb3073151-02 1 KU

Glucose 6-Phosphate Dehydrogenation

Sign In for Pricing
View Details
Glucose 6-Phosphate Dehydrogenation
orb3073151-03 10 KU

Glucose 6-Phosphate Dehydrogenation

Sign In for Pricing
View Details
Lentiviral human NPB shRNA (UAS) - Lentiviral human NPB shRNA (UAS, RFP) (100)
GTR15124776 1 Vial

Lentiviral human NPB shRNA (UAS) - Lentiviral human NPB shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details