Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Nuclear export protein

This Virus Nuclear export protein spans the amino acid sequence from region 1-122aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NEP (Non-structural protein 2) (NS2)

UniProt

P08014

Expression Region

1-122aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Influenza B virus (strain B/Yamagata/1/1973)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit heparan sulfate, HS; HPS ELISA KIT
E0401Rb-01 48 Well

Rabbit heparan sulfate, HS; HPS ELISA KIT

Sign In for Pricing
View Details
Rabbit heparan sulfate, HS; HPS ELISA KIT
E0401Rb-02 96 Well

Rabbit heparan sulfate, HS; HPS ELISA KIT

Sign In for Pricing
View Details
Rabbit heparan sulfate, HS; HPS ELISA KIT
E0401Rb-03 5x 96 Tests

Rabbit heparan sulfate, HS; HPS ELISA KIT

Sign In for Pricing
View Details
Rabbit heparan sulfate, HS; HPS ELISA KIT
E0401Rb-04 10x 96 Tests

Rabbit heparan sulfate, HS; HPS ELISA KIT

Sign In for Pricing
View Details
Olfr19-set siRNA/shRNA/RNAi Lentivector (Mouse)
32968094 4x 500 ng

Olfr19-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
LRRC37A16P Protein Lysate (Human) with C-Ha Tag
27653031 100 µg

LRRC37A16P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details