Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria fbpA protein

This Bacteria fbpA protein spans the amino acid sequence from region 44-338aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DGAT (Acyl-CoA, diacylglycerol acyltransferase) (Antigen 85 complex A) (85A) (Ag85A) (Fibronectin-binding protein A) (Fbps A) (mpt44)

UniProt

P9WQP2

Expression Region

44-338aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MYRIP Antibody
CTA2713-01 30 µL

Anti-MYRIP Antibody

Sign In for Pricing
View Details
Anti-MYRIP Antibody
CTA2713-02 50 μL

Anti-MYRIP Antibody

Sign In for Pricing
View Details
Anti-MYRIP Antibody
CTA2713-03 100 µL

Anti-MYRIP Antibody

Sign In for Pricing
View Details
Anti-MYRIP Antibody
CTA2713-04 200 µL

Anti-MYRIP Antibody

Sign In for Pricing
View Details
A27L Antibody
A78049-100UL 100 µL

A27L Antibody

Sign In for Pricing
View Details
Fast Green FCF
BUP18564-01 500 mg

Fast Green FCF

Sign In for Pricing
View Details