Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Hypodermin-A protein

This Insect Hypodermin-A protein spans the amino acid sequence from region 31-256aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HA

UniProt

P35587

Expression Region

31-256aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Hypoderma lineatum (Early cattle grub) (Common cattle grub)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGVESKIEDFPWQISLQRDGRHYCGGSIYSKNVIITAAHCLRNVVAEELRVRVGSSYWEHGGSLRNISKFQIHESYVEPTKEYDVALLKLDSDLSFNSTIKAIELTNEIPPEYADAIVSGWGETLVPPPGIPDQLRSVDVKIIHREKCASRNFGYGSNIKASMICAYAIGKDSCQGDSGGPLVVNNLLVGVVSWGIDCARPSYPGVYVDVSHVRSWIVSNAESI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Esrp2 Rabbit Polyclonal Antibody
orb578497 100 µL

Esrp2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-1285-5p miRNA Inhibitor
orb1871620-01 10 nmol

Hsa-miR-1285-5p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-1285-5p miRNA Inhibitor
orb1871620-02 20 nmol

Hsa-miR-1285-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mouse HMGB1 shRNA Plasmid
abx970817-01 150 µg

Mouse HMGB1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse HMGB1 shRNA Plasmid
abx970817-02 300 µg

Mouse HMGB1 shRNA Plasmid

Sign In for Pricing
View Details
Anti-LYN (phospho-Y192) Antibody
A01424Y192 100 µL

Anti-LYN (phospho-Y192) Antibody

Sign In for Pricing
View Details